Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4415542..4416323 | Replicon | chromosome |
Accession | NZ_CP101386 | ||
Organism | Salmonella enterica strain SC2017100 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NMU37_RS21685 | Protein ID | WP_000626099.1 |
Coordinates | 4415542..4416033 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NMU37_RS21690 | Protein ID | WP_001110452.1 |
Coordinates | 4416030..4416323 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU37_RS21650 (4411537) | 4411537..4412112 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
NMU37_RS21660 (4412383) | 4412383..4412460 | - | 78 | Protein_4236 | helix-turn-helix domain-containing protein | - |
NMU37_RS21665 (4412551) | 4412551..4412883 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NMU37_RS21670 (4412955) | 4412955..4413332 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NMU37_RS21675 (4414365) | 4414365..4414439 | + | 75 | Protein_4239 | porin family protein | - |
NMU37_RS21680 (4414542) | 4414542..4415294 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NMU37_RS21685 (4415542) | 4415542..4416033 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NMU37_RS21690 (4416030) | 4416030..4416323 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NMU37_RS21695 (4416640) | 4416640..4416861 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NMU37_RS21700 (4417126) | 4417126..4418001 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NMU37_RS21705 (4417998) | 4417998..4418285 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NMU37_RS21710 (4418308) | 4418308..4418523 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NMU37_RS21715 (4418531) | 4418531..4418800 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NMU37_RS21720 (4419094) | 4419094..4419999 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T252089 WP_000626099.1 NZ_CP101386:c4416033-4415542 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |