Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3569811..3570431 | Replicon | chromosome |
| Accession | NZ_CP101386 | ||
| Organism | Salmonella enterica strain SC2017100 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NMU37_RS17720 | Protein ID | WP_001280991.1 |
| Coordinates | 3570213..3570431 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NMU37_RS17715 | Protein ID | WP_000344807.1 |
| Coordinates | 3569811..3570185 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU37_RS17705 (3564950) | 3564950..3566143 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NMU37_RS17710 (3566166) | 3566166..3569315 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NMU37_RS17715 (3569811) | 3569811..3570185 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NMU37_RS17720 (3570213) | 3570213..3570431 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NMU37_RS17725 (3570610) | 3570610..3571161 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| NMU37_RS17730 (3571278) | 3571278..3571748 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| NMU37_RS17735 (3571804) | 3571804..3571944 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NMU37_RS17740 (3571950) | 3571950..3572210 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NMU37_RS17745 (3572435) | 3572435..3573985 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| NMU37_RS17755 (3574216) | 3574216..3574605 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| NMU37_RS17760 (3574638) | 3574638..3575207 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T252084 WP_001280991.1 NZ_CP101386:3570213-3570431 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT252084 WP_000344807.1 NZ_CP101386:3569811-3570185 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|