Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 951044..951704 | Replicon | chromosome |
Accession | NZ_CP101386 | ||
Organism | Salmonella enterica strain SC2017100 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | NMU37_RS04660 | Protein ID | WP_000244756.1 |
Coordinates | 951291..951704 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | NMU37_RS04655 | Protein ID | WP_000351186.1 |
Coordinates | 951044..951310 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU37_RS04635 (946972) | 946972..948405 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
NMU37_RS04640 (948564) | 948564..948875 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
NMU37_RS04645 (949039) | 949039..949698 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
NMU37_RS04650 (949814) | 949814..950794 | - | 981 | WP_000874172.1 | tRNA-modifying protein YgfZ | - |
NMU37_RS04655 (951044) | 951044..951310 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
NMU37_RS04660 (951291) | 951291..951704 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
NMU37_RS04665 (951757) | 951757..952278 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
NMU37_RS04670 (952391) | 952391..953287 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
NMU37_RS04675 (953311) | 953311..954024 | + | 714 | WP_000745625.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NMU37_RS04680 (954030) | 954030..955763 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T252076 WP_000244756.1 NZ_CP101386:951291-951704 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |