Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4400030..4400811 | Replicon | chromosome |
Accession | NZ_CP101382 | ||
Organism | Salmonella enterica strain SC2017030 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NMU36_RS21600 | Protein ID | WP_000626099.1 |
Coordinates | 4400030..4400521 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NMU36_RS21605 | Protein ID | WP_001110452.1 |
Coordinates | 4400518..4400811 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU36_RS21565 (4396025) | 4396025..4396600 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
NMU36_RS21575 (4396871) | 4396871..4396948 | - | 78 | Protein_4219 | helix-turn-helix domain-containing protein | - |
NMU36_RS21580 (4397039) | 4397039..4397371 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NMU36_RS21585 (4397443) | 4397443..4397820 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NMU36_RS21590 (4398853) | 4398853..4398927 | + | 75 | Protein_4222 | porin family protein | - |
NMU36_RS21595 (4399030) | 4399030..4399782 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NMU36_RS21600 (4400030) | 4400030..4400521 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NMU36_RS21605 (4400518) | 4400518..4400811 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NMU36_RS21610 (4401128) | 4401128..4401349 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NMU36_RS21615 (4401614) | 4401614..4402489 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NMU36_RS21620 (4402486) | 4402486..4402773 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NMU36_RS21625 (4402796) | 4402796..4403011 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NMU36_RS21630 (4403019) | 4403019..4403288 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NMU36_RS21635 (4403582) | 4403582..4404487 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T252069 WP_000626099.1 NZ_CP101382:c4400521-4400030 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |