Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4270684..4271200 | Replicon | chromosome |
| Accession | NZ_CP101382 | ||
| Organism | Salmonella enterica strain SC2017030 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | NMU36_RS20925 | Protein ID | WP_000220578.1 |
| Coordinates | 4270684..4270968 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | NMU36_RS20930 | Protein ID | WP_000212724.1 |
| Coordinates | 4270958..4271200 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU36_RS20910 (4265896) | 4265896..4267548 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
| NMU36_RS20915 (4267957) | 4267957..4270095 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NMU36_RS20920 (4270216) | 4270216..4270680 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NMU36_RS20925 (4270684) | 4270684..4270968 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMU36_RS20930 (4270958) | 4270958..4271200 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NMU36_RS20935 (4271278) | 4271278..4273191 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
| NMU36_RS20940 (4273208) | 4273208..4273948 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
| NMU36_RS20945 (4273945) | 4273945..4275063 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NMU36_RS20950 (4275047) | 4275047..4276180 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T252068 WP_000220578.1 NZ_CP101382:c4270968-4270684 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |