Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3557506..3558126 | Replicon | chromosome |
Accession | NZ_CP101382 | ||
Organism | Salmonella enterica strain SC2017030 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NMU36_RS17650 | Protein ID | WP_001280991.1 |
Coordinates | 3557908..3558126 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NMU36_RS17645 | Protein ID | WP_000344807.1 |
Coordinates | 3557506..3557880 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU36_RS17635 (3552645) | 3552645..3553838 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NMU36_RS17640 (3553861) | 3553861..3557010 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NMU36_RS17645 (3557506) | 3557506..3557880 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NMU36_RS17650 (3557908) | 3557908..3558126 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NMU36_RS17655 (3558305) | 3558305..3558856 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NMU36_RS17660 (3558973) | 3558973..3559443 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NMU36_RS17665 (3559499) | 3559499..3559639 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NMU36_RS17670 (3559645) | 3559645..3559905 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NMU36_RS17675 (3560130) | 3560130..3561680 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NMU36_RS17685 (3561911) | 3561911..3562300 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NMU36_RS17690 (3562333) | 3562333..3562902 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T252064 WP_001280991.1 NZ_CP101382:3557908-3558126 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT252064 WP_000344807.1 NZ_CP101382:3557506-3557880 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|