Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4439735..4440516 | Replicon | chromosome |
Accession | NZ_CP101379 | ||
Organism | Salmonella enterica strain SC2016290 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NMU35_RS21855 | Protein ID | WP_000626099.1 |
Coordinates | 4439735..4440226 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NMU35_RS21860 | Protein ID | WP_001110452.1 |
Coordinates | 4440223..4440516 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU35_RS21815 (4434921) | 4434921..4435163 | - | 243 | WP_197603740.1 | hypothetical protein | - |
NMU35_RS21820 (4435160) | 4435160..4435516 | - | 357 | WP_033567083.1 | hypothetical protein | - |
NMU35_RS21825 (4435513) | 4435513..4436385 | - | 873 | WP_033567082.1 | ParA family protein | - |
NMU35_RS21830 (4436576) | 4436576..4436653 | - | 78 | Protein_4270 | helix-turn-helix domain-containing protein | - |
NMU35_RS21835 (4436744) | 4436744..4437076 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NMU35_RS21840 (4437148) | 4437148..4437525 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NMU35_RS21845 (4438558) | 4438558..4438632 | + | 75 | Protein_4273 | porin family protein | - |
NMU35_RS21850 (4438735) | 4438735..4439487 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NMU35_RS21855 (4439735) | 4439735..4440226 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NMU35_RS21860 (4440223) | 4440223..4440516 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NMU35_RS21865 (4440833) | 4440833..4441054 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NMU35_RS21870 (4441319) | 4441319..4442194 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NMU35_RS21875 (4442191) | 4442191..4442478 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NMU35_RS21880 (4442501) | 4442501..4442716 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NMU35_RS21885 (4442724) | 4442724..4442993 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NMU35_RS21890 (4443287) | 4443287..4444192 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T252046 WP_000626099.1 NZ_CP101379:c4440226-4439735 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|