Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 108321..108964 | Replicon | plasmid pSC2016091-mcr-116k |
| Accession | NZ_CP101378 | ||
| Organism | Salmonella enterica strain SC2016091 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | NMU34_RS25235 | Protein ID | WP_001044768.1 |
| Coordinates | 108548..108964 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | NMU34_RS25230 | Protein ID | WP_001261287.1 |
| Coordinates | 108321..108551 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU34_RS25210 (103501) | 103501..104634 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
| NMU34_RS25215 (104897) | 104897..106534 | - | 1638 | WP_223201785.1 | hypothetical protein | - |
| NMU34_RS25220 (106585) | 106585..107415 | - | 831 | WP_223201786.1 | hypothetical protein | - |
| NMU34_RS25225 (107467) | 107467..108015 | - | 549 | WP_039002808.1 | hypothetical protein | - |
| NMU34_RS25230 (108321) | 108321..108551 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NMU34_RS25235 (108548) | 108548..108964 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NMU34_RS25240 (109126) | 109126..111264 | - | 2139 | WP_039002805.1 | AAA family ATPase | - |
| NMU34_RS25245 (111729) | 111729..112724 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| NMU34_RS25250 (112767) | 112767..113660 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / qnrS1 / mcr-3.1 / aac(3)-IId | - | 1..116686 | 116686 | |
| - | flank | IS/Tn | - | - | 113797..114174 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T252029 WP_001044768.1 NZ_CP101378:108548-108964 [Salmonella enterica]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |