Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3518338..3518958 | Replicon | chromosome |
Accession | NZ_CP101376 | ||
Organism | Salmonella enterica strain SC2016091 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NMU34_RS17440 | Protein ID | WP_001280991.1 |
Coordinates | 3518740..3518958 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NMU34_RS17435 | Protein ID | WP_000344807.1 |
Coordinates | 3518338..3518712 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU34_RS17425 (3513477) | 3513477..3514670 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NMU34_RS17430 (3514693) | 3514693..3517842 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NMU34_RS17435 (3518338) | 3518338..3518712 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NMU34_RS17440 (3518740) | 3518740..3518958 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NMU34_RS17445 (3519137) | 3519137..3519688 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NMU34_RS17450 (3519805) | 3519805..3520275 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NMU34_RS17455 (3520331) | 3520331..3520471 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NMU34_RS17460 (3520477) | 3520477..3520737 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NMU34_RS17465 (3520962) | 3520962..3522512 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NMU34_RS17475 (3522743) | 3522743..3523132 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NMU34_RS17480 (3523165) | 3523165..3523734 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T252018 WP_001280991.1 NZ_CP101376:3518740-3518958 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT252018 WP_000344807.1 NZ_CP101376:3518338-3518712 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|