Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4999462..5000243 | Replicon | chromosome |
Accession | NZ_CP101375 | ||
Organism | Salmonella enterica strain SC2016090 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NMU33_RS24605 | Protein ID | WP_000626099.1 |
Coordinates | 4999462..4999953 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NMU33_RS24610 | Protein ID | WP_001110452.1 |
Coordinates | 4999950..5000243 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU33_RS24570 (4995457) | 4995457..4996032 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
NMU33_RS24580 (4996303) | 4996303..4996380 | - | 78 | Protein_4801 | helix-turn-helix domain-containing protein | - |
NMU33_RS24585 (4996471) | 4996471..4996803 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NMU33_RS24590 (4996875) | 4996875..4997252 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NMU33_RS24595 (4998285) | 4998285..4998359 | + | 75 | Protein_4804 | porin family protein | - |
NMU33_RS24600 (4998462) | 4998462..4999214 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NMU33_RS24605 (4999462) | 4999462..4999953 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NMU33_RS24610 (4999950) | 4999950..5000243 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NMU33_RS24615 (5000560) | 5000560..5000781 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NMU33_RS24620 (5001046) | 5001046..5001921 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NMU33_RS24625 (5001918) | 5001918..5002205 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NMU33_RS24630 (5002228) | 5002228..5002443 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NMU33_RS24635 (5002451) | 5002451..5002720 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NMU33_RS24640 (5003014) | 5003014..5003919 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T252006 WP_000626099.1 NZ_CP101375:c4999953-4999462 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |