Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 26365..26830 Replicon plasmid pSC2016042-mcr-33k
Accession NZ_CP101374
Organism Salmonella enterica strain SC2016042

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag NMU32_RS24395 Protein ID WP_001230707.1
Coordinates 26365..26616 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag NMU32_RS24400 Protein ID WP_000801440.1
Coordinates 26603..26830 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMU32_RS24370 (NMU32_24365) 21846..22373 - 528 WP_000577043.1 DUF2726 domain-containing protein -
NMU32_RS24375 (NMU32_24370) 22508..22912 - 405 WP_012421203.1 hypothetical protein -
NMU32_RS24380 (NMU32_24375) 22925..23791 - 867 WP_001353743.1 replication initiation protein -
NMU32_RS24385 (NMU32_24380) 25206..25721 + 516 WP_001025395.1 J domain-containing protein -
NMU32_RS24390 (NMU32_24385) 25826..26368 + 543 WP_001083906.1 hypothetical protein -
NMU32_RS24395 (NMU32_24390) 26365..26616 + 252 WP_001230707.1 hypothetical protein Toxin
NMU32_RS24400 (NMU32_24395) 26603..26830 + 228 WP_000801440.1 hypothetical protein Antitoxin
NMU32_RS24405 (NMU32_24400) 27284..27583 + 300 WP_000650309.1 hypothetical protein -
NMU32_RS24410 (NMU32_24405) 27674..28024 + 351 WP_000854259.1 hypothetical protein -
NMU32_RS24415 (NMU32_24410) 28329..28577 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
NMU32_RS24420 (NMU32_24415) 28574..28921 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
NMU32_RS24425 (NMU32_24420) 29282..29785 + 504 WP_000781813.1 relaxosome-coupling protein TaxA -
NMU32_RS24430 (NMU32_24425) 29789..31018 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
NMU32_RS24435 (NMU32_24430) 31095..31388 + 294 WP_060598542.1 sigma factor-like helix-turn-helix DNA-binding protein -
NMU32_RS24440 (NMU32_24435) 31385..31600 + 216 WP_000760375.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 - 1..33309 33309


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T251985 WP_001230707.1 NZ_CP101374:26365-26616 [Salmonella enterica]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT251985 WP_000801440.1 NZ_CP101374:26603-26830 [Salmonella enterica]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References