Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4392899..4393680 | Replicon | chromosome |
Accession | NZ_CP101373 | ||
Organism | Salmonella enterica strain SC2016042 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NMU32_RS21555 | Protein ID | WP_000626099.1 |
Coordinates | 4392899..4393390 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NMU32_RS21560 | Protein ID | WP_001110452.1 |
Coordinates | 4393387..4393680 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU32_RS21520 (4388894) | 4388894..4389469 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
NMU32_RS21530 (4389740) | 4389740..4389817 | - | 78 | Protein_4210 | helix-turn-helix domain-containing protein | - |
NMU32_RS21535 (4389908) | 4389908..4390240 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NMU32_RS21540 (4390312) | 4390312..4390689 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NMU32_RS21545 (4391722) | 4391722..4391796 | + | 75 | Protein_4213 | porin family protein | - |
NMU32_RS21550 (4391899) | 4391899..4392651 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NMU32_RS21555 (4392899) | 4392899..4393390 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NMU32_RS21560 (4393387) | 4393387..4393680 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NMU32_RS21565 (4393997) | 4393997..4394218 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NMU32_RS21570 (4394483) | 4394483..4395358 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NMU32_RS21575 (4395355) | 4395355..4395642 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NMU32_RS21580 (4395665) | 4395665..4395880 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NMU32_RS21585 (4395888) | 4395888..4396157 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NMU32_RS21590 (4396451) | 4396451..4397356 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T251982 WP_000626099.1 NZ_CP101373:c4393390-4392899 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|