Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3550384..3551004 | Replicon | chromosome |
| Accession | NZ_CP101373 | ||
| Organism | Salmonella enterica strain SC2016042 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NMU32_RS17605 | Protein ID | WP_001280991.1 |
| Coordinates | 3550786..3551004 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NMU32_RS17600 | Protein ID | WP_000344807.1 |
| Coordinates | 3550384..3550758 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU32_RS17590 (3545523) | 3545523..3546716 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NMU32_RS17595 (3546739) | 3546739..3549888 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NMU32_RS17600 (3550384) | 3550384..3550758 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NMU32_RS17605 (3550786) | 3550786..3551004 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NMU32_RS17610 (3551183) | 3551183..3551734 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| NMU32_RS17615 (3551851) | 3551851..3552321 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| NMU32_RS17620 (3552377) | 3552377..3552517 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NMU32_RS17625 (3552523) | 3552523..3552783 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NMU32_RS17630 (3553008) | 3553008..3554558 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| NMU32_RS17640 (3554789) | 3554789..3555178 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| NMU32_RS17645 (3555211) | 3555211..3555780 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251977 WP_001280991.1 NZ_CP101373:3550786-3551004 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251977 WP_000344807.1 NZ_CP101373:3550384-3550758 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|