Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4687136..4687917 | Replicon | chromosome |
Accession | NZ_CP101372 | ||
Organism | Salmonella enterica strain SC2016025 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NMU31_RS23120 | Protein ID | WP_000626099.1 |
Coordinates | 4687136..4687627 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NMU31_RS23125 | Protein ID | WP_001110452.1 |
Coordinates | 4687624..4687917 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU31_RS23085 (4683131) | 4683131..4683706 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
NMU31_RS23095 (4683977) | 4683977..4684054 | - | 78 | Protein_4523 | helix-turn-helix domain-containing protein | - |
NMU31_RS23100 (4684145) | 4684145..4684477 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NMU31_RS23105 (4684549) | 4684549..4684926 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NMU31_RS23110 (4685959) | 4685959..4686033 | + | 75 | Protein_4526 | porin family protein | - |
NMU31_RS23115 (4686136) | 4686136..4686888 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NMU31_RS23120 (4687136) | 4687136..4687627 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NMU31_RS23125 (4687624) | 4687624..4687917 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NMU31_RS23130 (4688234) | 4688234..4688455 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NMU31_RS23135 (4688720) | 4688720..4689595 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NMU31_RS23140 (4689592) | 4689592..4689879 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NMU31_RS23145 (4689902) | 4689902..4690117 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NMU31_RS23150 (4690125) | 4690125..4690394 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NMU31_RS23155 (4690688) | 4690688..4691593 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T251963 WP_000626099.1 NZ_CP101372:c4687627-4687136 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |