Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3843547..3844167 | Replicon | chromosome |
| Accession | NZ_CP101372 | ||
| Organism | Salmonella enterica strain SC2016025 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NMU31_RS19165 | Protein ID | WP_001280991.1 |
| Coordinates | 3843949..3844167 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NMU31_RS19160 | Protein ID | WP_000344807.1 |
| Coordinates | 3843547..3843921 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU31_RS19150 (3838686) | 3838686..3839879 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NMU31_RS19155 (3839902) | 3839902..3843051 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NMU31_RS19160 (3843547) | 3843547..3843921 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NMU31_RS19165 (3843949) | 3843949..3844167 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NMU31_RS19170 (3844346) | 3844346..3844897 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| NMU31_RS19175 (3845014) | 3845014..3845484 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| NMU31_RS19180 (3845540) | 3845540..3845680 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NMU31_RS19185 (3845686) | 3845686..3845946 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NMU31_RS19190 (3846171) | 3846171..3847721 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| NMU31_RS19200 (3847952) | 3847952..3848341 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| NMU31_RS19205 (3848374) | 3848374..3848943 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | allD / allC / allB / allR / allA / allS / acrA / acrB | 3772850..4020630 | 247780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251958 WP_001280991.1 NZ_CP101372:3843949-3844167 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251958 WP_000344807.1 NZ_CP101372:3843547-3843921 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|