251941

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 17211..17676 Replicon plasmid pSC2014238-mcr-33k
Accession NZ_CP101370
Organism Salmonella enterica strain SC2014238

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag NMU30_RS24380 Protein ID WP_001230707.1
Coordinates 17425..17676 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag NMU30_RS24375 Protein ID WP_000801440.1
Coordinates 17211..17438 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMU30_RS24335 (NMU30_24320) 12441..12656 - 216 WP_000760375.1 EexN family lipoprotein -
NMU30_RS24340 (NMU30_24325) 12653..12946 - 294 WP_060598542.1 sigma factor-like helix-turn-helix DNA-binding protein -
NMU30_RS24345 (NMU30_24330) 13023..14252 - 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
NMU30_RS24350 (NMU30_24335) 14256..14759 - 504 WP_000781813.1 relaxosome-coupling protein TaxA -
NMU30_RS24355 (NMU30_24340) 15120..15467 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
NMU30_RS24360 (NMU30_24345) 15464..15712 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
NMU30_RS24365 (NMU30_24350) 16017..16367 - 351 WP_000854259.1 hypothetical protein -
NMU30_RS24370 (NMU30_24355) 16458..16757 - 300 WP_000650309.1 hypothetical protein -
NMU30_RS24375 (NMU30_24360) 17211..17438 - 228 WP_000801440.1 hypothetical protein Antitoxin
NMU30_RS24380 (NMU30_24365) 17425..17676 - 252 WP_001230707.1 hypothetical protein Toxin
NMU30_RS24385 (NMU30_24370) 17673..18215 - 543 WP_001083906.1 hypothetical protein -
NMU30_RS24390 (NMU30_24375) 18320..18835 - 516 WP_001025395.1 J domain-containing protein -
NMU30_RS24395 (NMU30_24380) 20250..21116 + 867 WP_001353743.1 replication initiation protein -
NMU30_RS24400 (NMU30_24385) 21129..21533 + 405 WP_012421203.1 hypothetical protein -
NMU30_RS24405 (NMU30_24390) 21668..22195 + 528 WP_000577043.1 DUF2726 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 - 1..33309 33309


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T251941 WP_001230707.1 NZ_CP101370:c17676-17425 [Salmonella enterica]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT251941 WP_000801440.1 NZ_CP101370:c17438-17211 [Salmonella enterica]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References