Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4282330..4282846 | Replicon | chromosome |
Accession | NZ_CP101369 | ||
Organism | Salmonella enterica strain SC2014238 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5I6CHB9 |
Locus tag | NMU30_RS21270 | Protein ID | WP_000220581.1 |
Coordinates | 4282330..4282614 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | NMU30_RS21275 | Protein ID | WP_000212724.1 |
Coordinates | 4282604..4282846 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU30_RS21255 (4277446) | 4277446..4279098 | + | 1653 | WP_070793923.1 | alpha,alpha-phosphotrehalase | - |
NMU30_RS21260 (4279507) | 4279507..4281645 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NMU30_RS21265 (4281862) | 4281862..4282326 | + | 465 | WP_001009175.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NMU30_RS21270 (4282330) | 4282330..4282614 | - | 285 | WP_000220581.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMU30_RS21275 (4282604) | 4282604..4282846 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NMU30_RS21280 (4282924) | 4282924..4284837 | - | 1914 | WP_023216476.1 | BglG family transcription antiterminator | - |
NMU30_RS21285 (4284854) | 4284854..4285594 | - | 741 | WP_000779254.1 | KDGP aldolase family protein | - |
NMU30_RS21290 (4285591) | 4285591..4286709 | - | 1119 | WP_023216475.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NMU30_RS21295 (4286693) | 4286693..4287826 | - | 1134 | WP_023216474.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.70 Da Isoelectric Point: 10.0482
>T251937 WP_000220581.1 NZ_CP101369:c4282614-4282330 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I6CHB9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |