Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4241668..4242218 | Replicon | chromosome |
Accession | NZ_CP101369 | ||
Organism | Salmonella enterica strain SC2014238 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | NMU30_RS21065 | Protein ID | WP_001199743.1 |
Coordinates | 4241668..4241976 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | NMU30_RS21070 | Protein ID | WP_000016244.1 |
Coordinates | 4241979..4242218 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU30_RS21045 (4238380) | 4238380..4239159 | - | 780 | WP_023216488.1 | HNH endonuclease | - |
NMU30_RS21050 (4239320) | 4239320..4239478 | + | 159 | WP_023216487.1 | hypothetical protein | - |
NMU30_RS21060 (4240986) | 4240986..4241236 | - | 251 | Protein_4059 | Arm DNA-binding domain-containing protein | - |
NMU30_RS21065 (4241668) | 4241668..4241976 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
NMU30_RS21070 (4241979) | 4241979..4242218 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NMU30_RS21075 (4242327) | 4242327..4242575 | - | 249 | WP_000254751.1 | ribbon-helix-helix domain-containing protein | - |
NMU30_RS21080 (4242766) | 4242766..4243197 | - | 432 | Protein_4063 | helix-turn-helix domain-containing protein | - |
NMU30_RS21090 (4243955) | 4243955..4244974 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
NMU30_RS21095 (4245002) | 4245002..4245532 | - | 531 | WP_000896756.1 | gluconokinase | - |
NMU30_RS21100 (4245749) | 4245749..4246780 | + | 1032 | WP_023216483.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 4239694..4243152 | 3458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T251936 WP_001199743.1 NZ_CP101369:c4241976-4241668 [Salmonella enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |