Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3569387..3570007 | Replicon | chromosome |
Accession | NZ_CP101369 | ||
Organism | Salmonella enterica strain SC2014238 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NMU30_RS17990 | Protein ID | WP_001280991.1 |
Coordinates | 3569789..3570007 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NMU30_RS17985 | Protein ID | WP_000344807.1 |
Coordinates | 3569387..3569761 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU30_RS17975 (3564526) | 3564526..3565719 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NMU30_RS17980 (3565742) | 3565742..3568891 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NMU30_RS17985 (3569387) | 3569387..3569761 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NMU30_RS17990 (3569789) | 3569789..3570007 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NMU30_RS17995 (3570186) | 3570186..3570737 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NMU30_RS18000 (3570854) | 3570854..3571324 | + | 471 | WP_000136183.1 | YlaC family protein | - |
NMU30_RS18005 (3571380) | 3571380..3571520 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NMU30_RS18010 (3571526) | 3571526..3571786 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NMU30_RS18015 (3572011) | 3572011..3573561 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NMU30_RS18025 (3573792) | 3573792..3574181 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NMU30_RS18030 (3574214) | 3574214..3574783 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251933 WP_001280991.1 NZ_CP101369:3569789-3570007 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251933 WP_000344807.1 NZ_CP101369:3569387-3569761 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|