Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2475339..2475861 | Replicon | chromosome |
Accession | NZ_CP101369 | ||
Organism | Salmonella enterica strain SC2014238 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | - |
Locus tag | NMU30_RS12395 | Protein ID | WP_023216422.1 |
Coordinates | 2475577..2475861 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NMU30_RS12390 | Protein ID | WP_000885424.1 |
Coordinates | 2475339..2475587 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU30_RS12365 (2470384) | 2470384..2471292 | - | 909 | WP_001176641.1 | LysR family transcriptional regulator | - |
NMU30_RS12370 (2472228) | 2472228..2473008 | + | 781 | Protein_2359 | helix-turn-helix domain-containing protein | - |
NMU30_RS12375 (2473010) | 2473010..2473423 | - | 414 | Protein_2360 | hypothetical protein | - |
NMU30_RS12380 (2474181) | 2474181..2474570 | + | 390 | WP_023216421.1 | hypothetical protein | - |
NMU30_RS12385 (2474573) | 2474573..2474926 | + | 354 | WP_000418733.1 | hypothetical protein | - |
NMU30_RS12390 (2475339) | 2475339..2475587 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NMU30_RS12395 (2475577) | 2475577..2475861 | + | 285 | WP_023216422.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMU30_RS12400 (2476032) | 2476032..2476421 | + | 390 | WP_000194089.1 | RidA family protein | - |
NMU30_RS12405 (2476469) | 2476469..2477548 | - | 1080 | WP_023216423.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NMU30_RS12410 (2477741) | 2477741..2478229 | - | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NMU30_RS12415 (2478274) | 2478274..2479782 | + | 1509 | WP_000199412.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2467512..2482639 | 15127 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11105.87 Da Isoelectric Point: 10.5388
>T251932 WP_023216422.1 NZ_CP101369:2475577-2475861 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPWVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPWVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|