Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1995380..1995970 | Replicon | chromosome |
Accession | NZ_CP101369 | ||
Organism | Salmonella enterica strain SC2014238 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A8E7N510 |
Locus tag | NMU30_RS09980 | Protein ID | WP_070793950.1 |
Coordinates | 1995638..1995970 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A5X3P062 |
Locus tag | NMU30_RS09975 | Protein ID | WP_023216880.1 |
Coordinates | 1995380..1995637 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU30_RS09960 (1992041) | 1992041..1993996 | - | 1956 | WP_070793949.1 | hypothetical protein | - |
NMU30_RS09965 (1994356) | 1994356..1994829 | + | 474 | WP_023216882.1 | hypothetical protein | - |
NMU30_RS09970 (1994826) | 1994826..1995032 | + | 207 | WP_024147225.1 | helix-turn-helix transcriptional regulator | - |
NMU30_RS09975 (1995380) | 1995380..1995637 | + | 258 | WP_023216880.1 | antitoxin PemI | Antitoxin |
NMU30_RS09980 (1995638) | 1995638..1995970 | + | 333 | WP_070793950.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NMU30_RS09985 (1996817) | 1996817..1997701 | + | 885 | WP_023216878.1 | integrase domain-containing protein | - |
NMU30_RS09990 (1998731) | 1998731..1999993 | - | 1263 | WP_023216875.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11765.58 Da Isoelectric Point: 10.2965
>T251926 WP_070793950.1 NZ_CP101369:1995638-1995970 [Salmonella enterica]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSQASFNKLTRLPVIVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSQASFNKLTRLPVIVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|