Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 225488..226248 | Replicon | chromosome |
Accession | NZ_CP101369 | ||
Organism | Salmonella enterica strain SC2014238 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A8E7JZU9 |
Locus tag | NMU30_RS01355 | Protein ID | WP_023216228.1 |
Coordinates | 225763..226248 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | Q8Z2B2 |
Locus tag | NMU30_RS01350 | Protein ID | WP_000965889.1 |
Coordinates | 225488..225775 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU30_RS01335 (221916) | 221916..222344 | + | 429 | Protein_204 | IS3 family transposase | - |
NMU30_RS01340 (222540) | 222540..223310 | - | 771 | WP_000456879.1 | DUF3800 domain-containing protein | - |
NMU30_RS01345 (224337) | 224337..225365 | + | 1029 | WP_023196719.1 | HNH endonuclease signature motif containing protein | - |
NMU30_RS01350 (225488) | 225488..225775 | + | 288 | WP_000965889.1 | DUF1778 domain-containing protein | Antitoxin |
NMU30_RS01355 (225763) | 225763..226248 | + | 486 | WP_023216228.1 | GNAT family N-acetyltransferase | Toxin |
NMU30_RS01360 (226619) | 226619..227158 | - | 540 | WP_000047140.1 | copper-binding periplasmic metallochaperone CueP | - |
NMU30_RS01365 (227331) | 227331..227543 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
NMU30_RS01370 (227831) | 227831..228121 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
NMU30_RS01375 (228560) | 228560..229270 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
NMU30_RS01380 (229320) | 229320..230294 | - | 975 | WP_023216229.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
NMU30_RS01385 (230513) | 230513..231175 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17685.37 Da Isoelectric Point: 9.8719
>T251922 WP_023216228.1 NZ_CP101369:225763-226248 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNI
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNI
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|