Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 52442..52964 Replicon plasmid pSC2014107-mcr-62k
Accession NZ_CP101366
Organism Salmonella enterica strain SC2014107

Toxin (Protein)


Gene name relE Uniprot ID U9YLU1
Locus tag NM059_RS24180 Protein ID WP_000638823.1
Coordinates 52442..52723 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y7J1
Locus tag NM059_RS24185 Protein ID WP_000121741.1
Coordinates 52713..52964 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NM059_RS24145 (NM059_24140) 48591..48911 - 321 WP_000362080.1 VirB3 family type IV secretion system protein -
NM059_RS24150 (NM059_24145) 48982..49272 - 291 WP_000865479.1 conjugal transfer protein -
NM059_RS24155 (NM059_24150) 49272..49856 - 585 WP_001177113.1 lytic transglycosylase domain-containing protein -
NM059_RS24160 (NM059_24155) 49877..50275 - 399 WP_001153665.1 hypothetical protein -
NM059_RS24165 (NM059_24160) 50394..50831 - 438 WP_000539665.1 type IV pilus biogenesis protein PilM -
NM059_RS24170 (NM059_24165) 50837..52072 - 1236 WP_015059538.1 TcpQ domain-containing protein -
NM059_RS24175 (NM059_24170) 52075..52374 - 300 WP_000835764.1 TrbM/KikA/MpfK family conjugal transfer protein -
NM059_RS24180 (NM059_24175) 52442..52723 - 282 WP_000638823.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NM059_RS24185 (NM059_24180) 52713..52964 - 252 WP_000121741.1 hypothetical protein Antitoxin
NM059_RS24190 (NM059_24185) 53064..53699 - 636 WP_086722071.1 hypothetical protein -
NM059_RS24195 (NM059_24190) 53747..54556 + 810 WP_172690499.1 DUF5710 domain-containing protein -
NM059_RS24200 (NM059_24195) 54779..55003 - 225 WP_000713562.1 EexN family lipoprotein -
NM059_RS24205 (NM059_24200) 55012..55656 - 645 WP_086722072.1 type IV secretion system protein -
NM059_RS24210 (NM059_24205) 55662..56657 - 996 WP_001028540.1 type IV secretion system protein -
NM059_RS24215 (NM059_24210) 56661..56918 - 258 WP_000739144.1 hypothetical protein -
NM059_RS24220 (NM059_24215) 56915..57217 - 303 WP_001360345.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62098 62098


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10945.79 Da        Isoelectric Point: 10.4997

>T251920 WP_000638823.1 NZ_CP101366:c52723-52442 [Salmonella enterica]
MIYELAFDHRALKEWQKLGHTVREQFKKKLSERLINPRVPAAKLHGHTDRYKIKLRASGYRLVYQVIDEKVVLLVISVGK
REGSDVYHMADTR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9223.38 Da        Isoelectric Point: 3.9823

>AT251920 WP_000121741.1 NZ_CP101366:c52964-52713 [Salmonella enterica]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVRVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YLU1

Antitoxin

Source ID Structure
AlphaFold DB U9Y7J1

References