251919

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 6864..7357 Replicon plasmid pSC2014107-mcr-62k
Accession NZ_CP101366
Organism Salmonella enterica strain SC2014107

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag NM059_RS23945 Protein ID WP_001230709.1
Coordinates 6864..7118 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag NM059_RS23950 Protein ID WP_000151456.1
Coordinates 7115..7357 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NM059_RS23905 (NM059_23900) 2376..2528 + 153 Protein_1 FlmC family protein -
NM059_RS23910 (NM059_23905) 2476..2595 + 120 WP_227525580.1 Hok/Gef family protein -
NM059_RS23915 (NM059_23910) 2744..3340 + 597 WP_000125165.1 ProQ/FINO family protein -
NM059_RS23920 (NM059_23915) 3358..3642 - 285 WP_001542021.1 hypothetical protein -
NM059_RS23925 (NM059_23920) 3721..4386 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
NM059_RS23930 (NM059_23925) 4976..5305 + 330 WP_001542022.1 hypothetical protein -
NM059_RS23935 (NM059_23930) 5706..6221 + 516 WP_001025393.1 J domain-containing protein -
NM059_RS23940 (NM059_23935) 6325..6867 + 543 WP_001083904.1 hypothetical protein -
NM059_RS23945 (NM059_23940) 6864..7118 + 255 WP_001230709.1 hypothetical protein Toxin
NM059_RS23950 (NM059_23945) 7115..7357 + 243 WP_000151456.1 hypothetical protein Antitoxin
NM059_RS23955 (NM059_23950) 7928..8221 + 294 WP_000673428.1 hypothetical protein -
NM059_RS23960 (NM059_23955) 8633..9076 - 444 WP_000192626.1 hypothetical protein -
NM059_RS23965 (NM059_23960) 9373..9555 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
NM059_RS23970 (NM059_23965) 9580..10017 + 438 WP_023225990.1 type II toxin-antitoxin system HicB family antitoxin -
NM059_RS23975 (NM059_23970) 10151..10336 - 186 Protein_15 hypothetical protein -
NM059_RS23980 (NM059_23975) 10494..11093 - 600 WP_000091423.1 hypothetical protein -
NM059_RS23985 (NM059_23980) 11140..11841 - 702 WP_000280995.1 StbB family protein -
NM059_RS23990 (NM059_23985) 11847..12326 - 480 WP_001058980.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62098 62098


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T251919 WP_001230709.1 NZ_CP101366:6864-7118 [Salmonella enterica]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT251919 WP_000151456.1 NZ_CP101366:7115-7357 [Salmonella enterica]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References