Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4345655..4346436 | Replicon | chromosome |
Accession | NZ_CP101365 | ||
Organism | Salmonella enterica strain SC2014107 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | NM059_RS21330 | Protein ID | WP_000626100.1 |
Coordinates | 4345655..4346146 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NM059_RS21335 | Protein ID | WP_001110452.1 |
Coordinates | 4346143..4346436 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NM059_RS21295 (4341650) | 4341650..4342225 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
NM059_RS21305 (4342496) | 4342496..4342573 | - | 78 | Protein_4167 | helix-turn-helix domain-containing protein | - |
NM059_RS21310 (4342664) | 4342664..4342996 | - | 333 | WP_001165472.1 | MerR family transcriptional regulator | - |
NM059_RS21315 (4343068) | 4343068..4343445 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NM059_RS21320 (4344478) | 4344478..4344552 | + | 75 | Protein_4170 | porin family protein | - |
NM059_RS21325 (4344655) | 4344655..4345407 | + | 753 | WP_000842427.1 | non-specific acid phosphatase | - |
NM059_RS21330 (4345655) | 4345655..4346146 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
NM059_RS21335 (4346143) | 4346143..4346436 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NM059_RS21340 (4346753) | 4346753..4346974 | + | 222 | WP_001654251.1 | hypothetical protein | - |
NM059_RS21345 (4347239) | 4347239..4348114 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
NM059_RS21350 (4348111) | 4348111..4348398 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
NM059_RS21355 (4348538) | 4348538..4348912 | + | 375 | WP_230320449.1 | Ig-like domain-containing protein | - |
NM059_RS21360 (4349207) | 4349207..4350112 | - | 906 | WP_001268198.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T251916 WP_000626100.1 NZ_CP101365:c4346146-4345655 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |