Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4206606..4207122 | Replicon | chromosome |
Accession | NZ_CP101365 | ||
Organism | Salmonella enterica strain SC2014107 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
Locus tag | NM059_RS20535 | Protein ID | WP_000220577.1 |
Coordinates | 4206606..4206890 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | NM059_RS20540 | Protein ID | WP_000212724.1 |
Coordinates | 4206880..4207122 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NM059_RS20520 (4201722) | 4201722..4203374 | + | 1653 | WP_079798427.1 | alpha,alpha-phosphotrehalase | - |
NM059_RS20525 (4203783) | 4203783..4205921 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NM059_RS20530 (4206138) | 4206138..4206602 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NM059_RS20535 (4206606) | 4206606..4206890 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NM059_RS20540 (4206880) | 4206880..4207122 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NM059_RS20545 (4207200) | 4207200..4209113 | - | 1914 | WP_001212131.1 | BglG family transcription antiterminator | - |
NM059_RS20550 (4209130) | 4209130..4209870 | - | 741 | WP_000779252.1 | KDGP aldolase family protein | - |
NM059_RS20555 (4209867) | 4209867..4210985 | - | 1119 | WP_001139178.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NM059_RS20560 (4210969) | 4210969..4212102 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T251915 WP_000220577.1 NZ_CP101365:c4206890-4206606 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |