Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3491285..3491905 | Replicon | chromosome |
Accession | NZ_CP101365 | ||
Organism | Salmonella enterica strain SC2014107 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NM059_RS17245 | Protein ID | WP_001280991.1 |
Coordinates | 3491687..3491905 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NM059_RS17240 | Protein ID | WP_000344807.1 |
Coordinates | 3491285..3491659 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NM059_RS17230 (3486424) | 3486424..3487617 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NM059_RS17235 (3487640) | 3487640..3490789 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NM059_RS17240 (3491285) | 3491285..3491659 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NM059_RS17245 (3491687) | 3491687..3491905 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NM059_RS17250 (3492084) | 3492084..3492635 | + | 552 | WP_001278791.1 | maltose O-acetyltransferase | - |
NM059_RS17255 (3492753) | 3492753..3493223 | + | 471 | WP_000136183.1 | YlaC family protein | - |
NM059_RS17260 (3493279) | 3493279..3493419 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NM059_RS17265 (3493425) | 3493425..3493685 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NM059_RS17270 (3493910) | 3493910..3495460 | + | 1551 | WP_076932570.1 | EAL domain-containing protein | - |
NM059_RS17280 (3495691) | 3495691..3496080 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NM059_RS17285 (3496113) | 3496113..3496682 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251910 WP_001280991.1 NZ_CP101365:3491687-3491905 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251910 WP_000344807.1 NZ_CP101365:3491285-3491659 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|