Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2414985..2415507 | Replicon | chromosome |
Accession | NZ_CP101365 | ||
Organism | Salmonella enterica strain SC2014107 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | NM059_RS11840 | Protein ID | WP_000221345.1 |
Coordinates | 2415223..2415507 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NM059_RS11835 | Protein ID | WP_000885424.1 |
Coordinates | 2414985..2415233 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NM059_RS11810 (2410621) | 2410621..2411529 | - | 909 | WP_079798353.1 | LysR family transcriptional regulator | - |
NM059_RS11815 (2412446) | 2412446..2413181 | + | 736 | Protein_2311 | helix-turn-helix domain-containing protein | - |
NM059_RS11820 (2413237) | 2413237..2414145 | - | 909 | WP_079798383.1 | hypothetical protein | - |
NM059_RS11825 (2414296) | 2414296..2414628 | - | 333 | WP_000253155.1 | DUF1493 family protein | - |
NM059_RS11830 (2414618) | 2414618..2414833 | - | 216 | WP_000206206.1 | hypothetical protein | - |
NM059_RS11835 (2414985) | 2414985..2415233 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NM059_RS11840 (2415223) | 2415223..2415507 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NM059_RS11845 (2415667) | 2415667..2416056 | + | 390 | WP_001652798.1 | RidA family protein | - |
NM059_RS11850 (2416108) | 2416108..2417187 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NM059_RS11855 (2417380) | 2417380..2417868 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NM059_RS11860 (2417913) | 2417913..2419421 | + | 1509 | WP_079798354.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2407749..2422278 | 14529 | |
- | flank | IS/Tn | - | - | 2412446..2413015 | 569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T251909 WP_000221345.1 NZ_CP101365:2415223-2415507 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |