Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1002040..1002854 | Replicon | chromosome |
Accession | NZ_CP101365 | ||
Organism | Salmonella enterica strain SC2014107 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | NM059_RS04870 | Protein ID | WP_000971658.1 |
Coordinates | 1002040..1002567 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NM059_RS04875 | Protein ID | WP_000855694.1 |
Coordinates | 1002564..1002854 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NM059_RS04840 (998251) | 998251..998648 | + | 398 | Protein_947 | cytoplasmic protein | - |
NM059_RS04845 (998839) | 998839..999027 | + | 189 | Protein_948 | hypothetical protein | - |
NM059_RS04850 (999235) | 999235..999903 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NM059_RS04855 (999930) | 999930..1000424 | + | 495 | WP_000424948.1 | hypothetical protein | - |
NM059_RS04860 (1000669) | 1000669..1001325 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NM059_RS04865 (1001558) | 1001558..1001967 | + | 410 | Protein_952 | IS5/IS1182 family transposase | - |
NM059_RS04870 (1002040) | 1002040..1002567 | - | 528 | WP_000971658.1 | GNAT family N-acetyltransferase | Toxin |
NM059_RS04875 (1002564) | 1002564..1002854 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NM059_RS04880 (1003124) | 1003124..1003324 | - | 201 | Protein_955 | IS3 family transposase | - |
NM059_RS04885 (1003565) | 1003565..1003891 | + | 327 | WP_000393305.1 | hypothetical protein | - |
NM059_RS04890 (1004164) | 1004164..1004511 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NM059_RS04895 (1004496) | 1004496..1004945 | - | 450 | WP_000381612.1 | membrane protein | - |
NM059_RS04900 (1005377) | 1005377..1005820 | - | 444 | WP_079798511.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NM059_RS04905 (1006276) | 1006276..1006926 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1001827..1001967 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19051.87 Da Isoelectric Point: 9.6420
>T251903 WP_000971658.1 NZ_CP101365:c1002567-1002040 [Salmonella enterica]
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTEWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSVQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|