Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 860355..860980 | Replicon | chromosome |
| Accession | NZ_CP101365 | ||
| Organism | Salmonella enterica strain SC2014107 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NM059_RS04235 | Protein ID | WP_000911337.1 |
| Coordinates | 860582..860980 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | NM059_RS04230 | Protein ID | WP_000557545.1 |
| Coordinates | 860355..860582 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NM059_RS04200 (855451) | 855451..856549 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
| NM059_RS04205 (856559) | 856559..858076 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| NM059_RS04210 (858152) | 858152..858697 | - | 546 | WP_050067887.1 | isopentenyl-diphosphate Delta-isomerase | - |
| NM059_RS04215 (858962) | 858962..859720 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
| NM059_RS04225 (859966) | 859966..860178 | - | 213 | WP_024152440.1 | hypothetical protein | - |
| NM059_RS04230 (860355) | 860355..860582 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NM059_RS04235 (860582) | 860582..860980 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NM059_RS04240 (861789) | 861789..862325 | + | 537 | WP_001038503.1 | STM3031 family outer membrane protein | - |
| NM059_RS04245 (862372) | 862372..863004 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| NM059_RS04250 (863723) | 863723..864310 | + | 588 | WP_001244643.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 860355..868770 | 8415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T251902 WP_000911337.1 NZ_CP101365:860582-860980 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|