Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 199826..200586 | Replicon | chromosome |
Accession | NZ_CP101365 | ||
Organism | Salmonella enterica strain SC2014107 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | NM059_RS00950 | Protein ID | WP_000533909.1 |
Coordinates | 200101..200586 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | NM059_RS00945 | Protein ID | WP_000965886.1 |
Coordinates | 199826..200113 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NM059_RS00925 (195231) | 195231..196142 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
NM059_RS00930 (196152) | 196152..198221 | + | 2070 | WP_001291739.1 | glycine--tRNA ligase subunit beta | - |
NM059_RS00935 (198611) | 198611..199009 | + | 399 | Protein_185 | IS3 family transposase | - |
NM059_RS00940 (199181) | 199181..199648 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
NM059_RS00945 (199826) | 199826..200113 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
NM059_RS00950 (200101) | 200101..200586 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
NM059_RS00955 (200957) | 200957..201496 | - | 540 | WP_000047147.1 | copper-binding periplasmic metallochaperone CueP | - |
NM059_RS00960 (201670) | 201670..201882 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
NM059_RS00965 (202171) | 202171..202461 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
NM059_RS00970 (202900) | 202900..203610 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
NM059_RS00975 (203660) | 203660..204634 | - | 975 | WP_000804683.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
NM059_RS00980 (204853) | 204853..205515 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T251900 WP_000533909.1 NZ_CP101365:200101-200586 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK8 | |
AlphaFold DB | A0A3V2JDX2 |