Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 82555..83198 Replicon plasmid pO145
Accession NZ_CP101311
Organism Escherichia coli strain 99-3311

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag NMK62_RS27320 Protein ID WP_001044768.1
Coordinates 82782..83198 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag NMK62_RS27315 Protein ID WP_001261287.1
Coordinates 82555..82785 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK62_RS27285 (NMK62_27285) 78420..79859 + 1440 WP_001213545.1 enterohemolysin T1SS ABC transporter subunit EhxD -
NMK62_RS27290 (NMK62_27290) 79926..80069 + 144 Protein_73 transcriptional regulator -
NMK62_RS27295 (NMK62_27295) 80073..80264 + 192 Protein_74 lipid II-degrading bacteriocin -
NMK62_RS27300 (NMK62_27300) 80272..80625 - 354 WP_000864810.1 colicin M immunity protein -
NMK62_RS27305 (NMK62_27305) 80798..81580 - 783 WP_001164205.1 site-specific integrase -
NMK62_RS27310 (NMK62_27310) 81582..81995 - 414 WP_000465041.1 hypothetical protein -
NMK62_RS27315 (NMK62_27315) 82555..82785 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NMK62_RS27320 (NMK62_27320) 82782..83198 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
NMK62_RS27325 (NMK62_27325) 83360..83905 - 546 WP_001165114.1 hypothetical protein -
NMK62_RS27330 (NMK62_27330) 84056..85269 + 1214 WP_136952279.1 IS3 family transposase -
NMK62_RS27335 (NMK62_27335) 85512..86372 - 861 WP_000704534.1 alpha/beta hydrolase -
NMK62_RS27340 (NMK62_27340) 86500..86856 + 357 Protein_83 tyrosine-type recombinase/integrase -
NMK62_RS27345 (NMK62_27345) 86940..87614 + 675 WP_001341423.1 IS66-like element accessory protein TnpA -
NMK62_RS27350 (NMK62_27350) 87611..87958 + 348 WP_000631725.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - toxB / toxB / toxB / toxB / toxB / toxB / toxB / toxB / toxB / toxB / espP / hlyC / hlyA / hlyB / hlyD 1..92345 92345


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T251899 WP_001044768.1 NZ_CP101311:82782-83198 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT251899 WP_001261287.1 NZ_CP101311:82555-82785 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References