Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4504930..4505480 Replicon chromosome
Accession NZ_CP101310
Organism Escherichia coli strain 99-3311

Toxin (Protein)


Gene name ccdB Uniprot ID Q32K46
Locus tag NMK62_RS22550 Protein ID WP_001160974.1
Coordinates 4504930..4505244 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NMK62_RS22555 Protein ID WP_000125566.1
Coordinates 4505247..4505480 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK62_RS22525 (4500605) 4500605..4501891 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
NMK62_RS22530 (4501891) 4501891..4502880 + 990 WP_000241240.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NMK62_RS22535 (4502877) 4502877..4503698 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NMK62_RS22540 (4503701) 4503701..4504078 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NMK62_RS22545 (4504085) 4504085..4504933 + 849 WP_000257203.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NMK62_RS22550 (4504930) 4504930..4505244 - 315 WP_001160974.1 CcdB family protein Toxin
NMK62_RS22555 (4505247) 4505247..4505480 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NMK62_RS22560 (4505566) 4505566..4506045 - 480 WP_024221573.1 type 3 dihydrofolate reductase -
NMK62_RS22565 (4506237) 4506237..4508099 - 1863 WP_000377137.1 glutathione-regulated potassium-efflux system protein KefC -
NMK62_RS22570 (4508092) 4508092..4508622 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NMK62_RS22575 (4508733) 4508733..4510064 - 1332 WP_001183192.1 MFS transporter -
NMK62_RS22580 (4510122) 4510122..4510409 - 288 WP_000203748.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11737.84 Da        Isoelectric Point: 9.8517

>T251896 WP_001160974.1 NZ_CP101310:c4505244-4504930 [Escherichia coli]
MQFTVYRSRSRNAAFPFVIDVTSDIIGVINRRIVIPLTPIERFIRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT251896 WP_000125566.1 NZ_CP101310:c4505480-4505247 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LRR3

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References