Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4076116..4076734 | Replicon | chromosome |
Accession | NZ_CP101310 | ||
Organism | Escherichia coli strain 99-3311 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NMK62_RS20565 | Protein ID | WP_001291435.1 |
Coordinates | 4076516..4076734 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NMK62_RS20560 | Protein ID | WP_000344800.1 |
Coordinates | 4076116..4076490 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK62_RS20550 (4071205) | 4071205..4072398 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NMK62_RS20555 (4072421) | 4072421..4075570 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NMK62_RS20560 (4076116) | 4076116..4076490 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NMK62_RS20565 (4076516) | 4076516..4076734 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NMK62_RS20570 (4076906) | 4076906..4077457 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NMK62_RS20575 (4077573) | 4077573..4078043 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NMK62_RS20580 (4078207) | 4078207..4079757 | + | 1551 | WP_024221674.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NMK62_RS20585 (4079799) | 4079799..4080152 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NMK62_RS20595 (4080531) | 4080531..4080842 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NMK62_RS20600 (4080873) | 4080873..4081445 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T251895 WP_001291435.1 NZ_CP101310:4076516-4076734 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT251895 WP_000344800.1 NZ_CP101310:4076116-4076490 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |