Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 3053614..3054093 Replicon chromosome
Accession NZ_CP101310
Organism Escherichia coli strain 99-3311

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A234Y3J1
Locus tag NMK62_RS15375 Protein ID WP_001444087.1
Coordinates 3053806..3054093 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID A0A234Y267
Locus tag NMK62_RS15370 Protein ID WP_001090455.1
Coordinates 3053614..3053802 (+) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK62_RS15320 (3048687) 3048687..3048863 - 177 WP_000753060.1 hypothetical protein -
NMK62_RS15325 (3048856) 3048856..3049038 - 183 WP_022581296.1 hypothetical protein -
NMK62_RS15330 (3049186) 3049186..3049491 - 306 WP_053294093.1 DUF4406 domain-containing protein -
NMK62_RS15335 (3049488) 3049488..3049769 - 282 WP_072094476.1 DNA-binding protein -
NMK62_RS15340 (3049802) 3049802..3050563 - 762 WP_254854422.1 DUF1627 domain-containing protein -
NMK62_RS15345 (3050593) 3050593..3051333 - 741 WP_000790460.1 ATP-binding protein -
NMK62_RS15350 (3051340) 3051340..3052305 - 966 WP_000054520.1 hypothetical protein -
NMK62_RS15355 (3052286) 3052286..3052807 - 522 WP_000705386.1 toxin YdaT family protein -
NMK62_RS15360 (3052791) 3052791..3053069 - 279 WP_000548554.1 YdaS family helix-turn-helix protein -
NMK62_RS15365 (3053186) 3053186..3053584 + 399 WP_000209117.1 helix-turn-helix domain-containing protein -
NMK62_RS15370 (3053614) 3053614..3053802 + 189 WP_001090455.1 hypothetical protein Antitoxin
NMK62_RS15375 (3053806) 3053806..3054093 + 288 WP_001444087.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NMK62_RS15380 (3054365) 3054365..3054517 + 153 WP_000380321.1 DUF1391 family protein -
NMK62_RS15385 (3054529) 3054529..3054897 + 369 WP_028985920.1 hypothetical protein -
NMK62_RS15390 (3055682) 3055682..3055870 + 189 WP_000450222.1 cell division inhibition protein DicB -
NMK62_RS15395 (3055867) 3055867..3056055 + 189 WP_022581374.1 DUF1482 family protein -
NMK62_RS15400 (3056148) 3056148..3058550 + 2403 WP_022581375.1 exonuclease -
NMK62_RS15405 (3058612) 3058612..3058881 + 270 WP_000003742.1 excisionase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - stx2B / stx2A 2998487..3065850 67363
- inside Prophage - stx2B / stx2A 2954519..3065850 111331


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11014.71 Da        Isoelectric Point: 6.2118

>T251893 WP_001444087.1 NZ_CP101310:3053806-3054093 [Escherichia coli]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVATLSIE
IVSVVHARRQFPKQN

Download         Length: 288 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 7249.25 Da        Isoelectric Point: 8.6832

>AT251893 WP_001090455.1 NZ_CP101310:3053614-3053802 [Escherichia coli]
MNTALSPMVSEFETIEQENSYNEWLRAKVAASLANPRPAIPHDEVERRMAERFAKMRKERSK

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A234Y3J1

Antitoxin

Source ID Structure
AlphaFold DB A0A234Y267

References