Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2621059..2621697 | Replicon | chromosome |
| Accession | NZ_CP101310 | ||
| Organism | Escherichia coli strain 99-3311 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NMK62_RS13005 | Protein ID | WP_000813794.1 |
| Coordinates | 2621521..2621697 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NMK62_RS13000 | Protein ID | WP_001270286.1 |
| Coordinates | 2621059..2621475 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK62_RS12980 (2616210) | 2616210..2617151 | - | 942 | WP_001251328.1 | ABC transporter permease | - |
| NMK62_RS12985 (2617152) | 2617152..2618165 | - | 1014 | WP_000220414.1 | ABC transporter ATP-binding protein | - |
| NMK62_RS12990 (2618183) | 2618183..2619328 | - | 1146 | WP_000335342.1 | ABC transporter substrate-binding protein | - |
| NMK62_RS12995 (2619574) | 2619574..2620980 | - | 1407 | WP_000760665.1 | PLP-dependent aminotransferase family protein | - |
| NMK62_RS13000 (2621059) | 2621059..2621475 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NMK62_RS13005 (2621521) | 2621521..2621697 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NMK62_RS13010 (2621919) | 2621919..2622149 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NMK62_RS13015 (2622241) | 2622241..2624202 | - | 1962 | WP_000218823.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NMK62_RS13020 (2624275) | 2624275..2624811 | - | 537 | WP_000429147.1 | DNA-binding transcriptional regulator SutR | - |
| NMK62_RS13025 (2624903) | 2624903..2626075 | + | 1173 | WP_001236321.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T251892 WP_000813794.1 NZ_CP101310:c2621697-2621521 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT251892 WP_001270286.1 NZ_CP101310:c2621475-2621059 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|