Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1039423..1040006 | Replicon | chromosome |
Accession | NZ_CP101310 | ||
Organism | Escherichia coli strain 99-3311 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7U9LIA0 |
Locus tag | NMK62_RS05120 | Protein ID | WP_000254747.1 |
Coordinates | 1039671..1040006 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | NMK62_RS05115 | Protein ID | WP_000581937.1 |
Coordinates | 1039423..1039671 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK62_RS05105 (1035762) | 1035762..1037063 | + | 1302 | WP_000046821.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
NMK62_RS05110 (1037111) | 1037111..1039345 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
NMK62_RS05115 (1039423) | 1039423..1039671 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NMK62_RS05120 (1039671) | 1039671..1040006 | + | 336 | WP_000254747.1 | endoribonuclease MazF | Toxin |
NMK62_RS05125 (1040077) | 1040077..1040868 | + | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NMK62_RS05130 (1041096) | 1041096..1042733 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NMK62_RS05135 (1042821) | 1042821..1044119 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T251885 WP_000254747.1 NZ_CP101310:1039671-1040006 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLYVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLYVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LIA0 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 1UB4 | |
PDB | 5CQX | |
PDB | 5CQY | |
PDB | 1MVF | |
PDB | 2MRN | |
PDB | 2MRU | |
AlphaFold DB | A0A7U9LMB4 |