Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 4057632..4058469 | Replicon | chromosome |
Accession | NZ_CP101305 | ||
Organism | Escherichia coli strain 2002-3211 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NMK57_RS20575 | Protein ID | WP_000227784.1 |
Coordinates | 4057927..4058469 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NMK57_RS20570 | Protein ID | WP_001297137.1 |
Coordinates | 4057632..4057943 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK57_RS20545 (4052652) | 4052652..4053599 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
NMK57_RS20550 (4053621) | 4053621..4055612 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NMK57_RS20555 (4055602) | 4055602..4056216 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NMK57_RS20560 (4056216) | 4056216..4056545 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NMK57_RS20565 (4056557) | 4056557..4057447 | + | 891 | WP_000971336.1 | heme o synthase | - |
NMK57_RS20570 (4057632) | 4057632..4057943 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NMK57_RS20575 (4057927) | 4057927..4058469 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NMK57_RS20580 (4058525) | 4058525..4059460 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
NMK57_RS20585 (4059868) | 4059868..4061232 | + | 1365 | WP_001000945.1 | MFS transporter | - |
NMK57_RS20590 (4061360) | 4061360..4061851 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NMK57_RS20595 (4062019) | 4062019..4062930 | + | 912 | WP_000705865.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T251873 WP_000227784.1 NZ_CP101305:4057927-4058469 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|