Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 3394120..3394598 Replicon chromosome
Accession NZ_CP101305
Organism Escherichia coli strain 2002-3211

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag NMK57_RS17400 Protein ID WP_001303876.1
Coordinates 3394311..3394598 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag NMK57_RS17395 Protein ID WP_000536233.1
Coordinates 3394120..3394311 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK57_RS17360 (3389503) 3389503..3390273 - 771 WP_000450862.1 DUF1627 domain-containing protein -
NMK57_RS17365 (3390299) 3390299..3391039 - 741 WP_000788752.1 ATP-binding protein -
NMK57_RS17370 (3391036) 3391036..3392160 - 1125 WP_072097015.1 DNA-binding protein -
NMK57_RS17375 (3392239) 3392239..3392694 + 456 WP_000273724.1 hypothetical protein -
NMK57_RS17380 (3392901) 3392901..3393326 - 426 WP_000693855.1 toxin YdaT family protein -
NMK57_RS17385 (3393310) 3393310..3393582 - 273 WP_000887453.1 YdaS family helix-turn-helix protein -
NMK57_RS17390 (3393691) 3393691..3394092 + 402 WP_000986592.1 helix-turn-helix domain-containing protein -
NMK57_RS17395 (3394120) 3394120..3394311 + 192 WP_000536233.1 hypothetical protein Antitoxin
NMK57_RS17400 (3394311) 3394311..3394598 + 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NMK57_RS17405 (3394875) 3394875..3395030 + 156 WP_000379575.1 DUF1391 family protein -
NMK57_RS17410 (3395172) 3395172..3395561 + 390 WP_000394511.1 hypothetical protein -
NMK57_RS17415 (3395748) 3395748..3395933 - 186 WP_001133046.1 hypothetical protein -
NMK57_RS17420 (3396507) 3396507..3396695 + 189 WP_000413705.1 cell division inhibition protein DicB -
NMK57_RS17425 (3396692) 3396692..3396883 + 192 WP_001098307.1 DUF1482 family protein -
NMK57_RS17430 (3396977) 3396977..3399448 + 2472 WP_054626455.1 exonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T251871 WP_001303876.1 NZ_CP101305:3394311-3394598 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT251871 WP_000536233.1 NZ_CP101305:3394120-3394311 [Escherichia coli]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References