Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1459374..1459999 | Replicon | chromosome |
| Accession | NZ_CP101305 | ||
| Organism | Escherichia coli strain 2002-3211 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NMK57_RS07200 | Protein ID | WP_000911330.1 |
| Coordinates | 1459601..1459999 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NMK57_RS07195 | Protein ID | WP_000450524.1 |
| Coordinates | 1459374..1459601 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK57_RS07170 (1455177) | 1455177..1455647 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| NMK57_RS07175 (1455647) | 1455647..1456219 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NMK57_RS07180 (1456365) | 1456365..1457243 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NMK57_RS07185 (1457260) | 1457260..1458294 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NMK57_RS07190 (1458507) | 1458507..1459220 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NMK57_RS07195 (1459374) | 1459374..1459601 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NMK57_RS07200 (1459601) | 1459601..1459999 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NMK57_RS07205 (1460146) | 1460146..1461009 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| NMK57_RS07210 (1461024) | 1461024..1463039 | + | 2016 | WP_000829325.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NMK57_RS07215 (1463113) | 1463113..1463810 | + | 698 | Protein_1412 | esterase | - |
| NMK57_RS07220 (1463920) | 1463920..1464120 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T251863 WP_000911330.1 NZ_CP101305:1459601-1459999 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|