Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 986247..986907 | Replicon | chromosome |
| Accession | NZ_CP101305 | ||
| Organism | Escherichia coli strain 2002-3211 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A3W5XVE6 |
| Locus tag | NMK57_RS04950 | Protein ID | WP_000244778.1 |
| Coordinates | 986494..986907 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NMK57_RS04945 | Protein ID | WP_000354046.1 |
| Coordinates | 986247..986513 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK57_RS04920 (981535) | 981535..982278 | + | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
| NMK57_RS04925 (982335) | 982335..983768 | - | 1434 | WP_001343615.1 | 6-phospho-beta-glucosidase BglA | - |
| NMK57_RS04930 (983813) | 983813..984124 | + | 312 | WP_001182947.1 | N(4)-acetylcytidine aminohydrolase | - |
| NMK57_RS04935 (984288) | 984288..984947 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NMK57_RS04940 (985024) | 985024..986004 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| NMK57_RS04945 (986247) | 986247..986513 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NMK57_RS04950 (986494) | 986494..986907 | + | 414 | WP_000244778.1 | protein YgfX | Toxin |
| NMK57_RS04955 (986941) | 986941..987462 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NMK57_RS04960 (987574) | 987574..988470 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NMK57_RS04965 (988494) | 988494..989204 | + | 711 | WP_000715231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NMK57_RS04970 (989210) | 989210..990943 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16275.23 Da Isoelectric Point: 11.7064
>T251860 WP_000244778.1 NZ_CP101305:986494-986907 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQRSR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQRSR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3W5XVE6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |