Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4743363..4744200 | Replicon | chromosome |
| Accession | NZ_CP101302 | ||
| Organism | Escherichia coli strain 2000-3039 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7U9LL67 |
| Locus tag | NMK59_RS23905 | Protein ID | WP_000854687.1 |
| Coordinates | 4743363..4743743 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9LJJ3 |
| Locus tag | NMK59_RS23910 | Protein ID | WP_001443392.1 |
| Coordinates | 4743832..4744200 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK59_RS23875 (4739005) | 4739005..4740846 | + | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
| NMK59_RS23880 (4740925) | 4740925..4741431 | - | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
| NMK59_RS23890 (4741731) | 4741731..4742576 | - | 846 | WP_001274557.1 | DUF4942 domain-containing protein | - |
| NMK59_RS23895 (4742661) | 4742661..4742858 | - | 198 | WP_000772026.1 | DUF957 domain-containing protein | - |
| NMK59_RS23900 (4742878) | 4742878..4743366 | - | 489 | WP_001054229.1 | DUF5983 family protein | - |
| NMK59_RS23905 (4743363) | 4743363..4743743 | - | 381 | WP_000854687.1 | TA system toxin CbtA family protein | Toxin |
| NMK59_RS23910 (4743832) | 4743832..4744200 | - | 369 | WP_001443392.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NMK59_RS23915 (4744276) | 4744276..4744497 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| NMK59_RS23920 (4744560) | 4744560..4745036 | - | 477 | WP_001186717.1 | RadC family protein | - |
| NMK59_RS23925 (4745052) | 4745052..4745525 | - | 474 | WP_001368734.1 | antirestriction protein | - |
| NMK59_RS23930 (4745619) | 4745619..4745864 | - | 246 | WP_001164974.1 | hypothetical protein | - |
| NMK59_RS23935 (4745864) | 4745864..4746304 | - | 441 | Protein_4686 | DUF945 domain-containing protein | - |
| NMK59_RS23940 (4746423) | 4746423..4748201 | - | 1779 | WP_001243195.1 | reverse transcriptase/maturase family protein | - |
| NMK59_RS23945 (4748714) | 4748714..4749094 | - | 381 | Protein_4688 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14199.13 Da Isoelectric Point: 6.8615
>T251850 WP_000854687.1 NZ_CP101302:c4743743-4743363 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNNITLGRHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNNITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13781.54 Da Isoelectric Point: 6.2049
>AT251850 WP_001443392.1 NZ_CP101302:c4744200-4743832 [Escherichia coli]
VSDTLHETNYPNDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLDDRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVALYAKGLTCDADTLGSCGYVYLAVYPTPDMKK
VSDTLHETNYPNDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLDDRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVALYAKGLTCDADTLGSCGYVYLAVYPTPDMKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LL67 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LJJ3 |