Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4466924..4467578 | Replicon | chromosome |
| Accession | NZ_CP101302 | ||
| Organism | Escherichia coli strain 2000-3039 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | NMK59_RS22465 | Protein ID | WP_000244772.1 |
| Coordinates | 4466924..4467331 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NMK59_RS22470 | Protein ID | WP_000354046.1 |
| Coordinates | 4467312..4467578 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK59_RS22445 (4462881) | 4462881..4464614 | - | 1734 | WP_000813223.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NMK59_RS22450 (4464620) | 4464620..4465330 | - | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NMK59_RS22455 (4465355) | 4465355..4466251 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NMK59_RS22460 (4466363) | 4466363..4466884 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NMK59_RS22465 (4466924) | 4466924..4467331 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
| NMK59_RS22470 (4467312) | 4467312..4467578 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NMK59_RS22475 (4467821) | 4467821..4468801 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| NMK59_RS22480 (4469054) | 4469054..4470034 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
| NMK59_RS22485 (4470157) | 4470157..4470816 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NMK59_RS22490 (4470980) | 4470980..4471291 | - | 312 | WP_001182947.1 | N(4)-acetylcytidine aminohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4469054..4470034 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T251848 WP_000244772.1 NZ_CP101302:c4467331-4466924 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |