Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3957163..3957788 | Replicon | chromosome |
| Accession | NZ_CP101302 | ||
| Organism | Escherichia coli strain 2000-3039 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NMK59_RS19980 | Protein ID | WP_000911330.1 |
| Coordinates | 3957163..3957561 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NMK59_RS19985 | Protein ID | WP_000450524.1 |
| Coordinates | 3957561..3957788 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK59_RS19960 (3953041) | 3953041..3953241 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| NMK59_RS19965 (3953351) | 3953351..3954049 | - | 699 | WP_000679812.1 | esterase | - |
| NMK59_RS19970 (3954123) | 3954123..3956138 | - | 2016 | WP_000829332.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NMK59_RS19975 (3956153) | 3956153..3957016 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| NMK59_RS19980 (3957163) | 3957163..3957561 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NMK59_RS19985 (3957561) | 3957561..3957788 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NMK59_RS19990 (3957942) | 3957942..3958655 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NMK59_RS19995 (3958868) | 3958868..3959902 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NMK59_RS20000 (3959919) | 3959919..3960797 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NMK59_RS20005 (3960943) | 3960943..3961515 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NMK59_RS20010 (3961515) | 3961515..3961985 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T251846 WP_000911330.1 NZ_CP101302:c3957561-3957163 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|