Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 1974985..1975463 Replicon chromosome
Accession NZ_CP101302
Organism Escherichia coli strain 2000-3039

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag NMK59_RS09360 Protein ID WP_001303876.1
Coordinates 1974985..1975272 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag NMK59_RS09365 Protein ID WP_000536233.1
Coordinates 1975272..1975463 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK59_RS09330 (1970135) 1970135..1972606 - 2472 WP_000034468.1 exonuclease -
NMK59_RS09335 (1972700) 1972700..1972891 - 192 WP_001098307.1 DUF1482 family protein -
NMK59_RS09340 (1972888) 1972888..1973076 - 189 WP_000413705.1 cell division inhibition protein DicB -
NMK59_RS09345 (1973650) 1973650..1973835 + 186 WP_001133046.1 hypothetical protein -
NMK59_RS09350 (1974022) 1974022..1974411 - 390 WP_000394511.1 hypothetical protein -
NMK59_RS09355 (1974553) 1974553..1974708 - 156 WP_000379575.1 DUF1391 family protein -
NMK59_RS09360 (1974985) 1974985..1975272 - 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NMK59_RS09365 (1975272) 1975272..1975463 - 192 WP_000536233.1 hypothetical protein Antitoxin
NMK59_RS09370 (1975491) 1975491..1975892 - 402 WP_000986592.1 helix-turn-helix domain-containing protein -
NMK59_RS09375 (1976001) 1976001..1976273 + 273 WP_000887453.1 YdaS family helix-turn-helix protein -
NMK59_RS09380 (1976257) 1976257..1976682 + 426 WP_000693855.1 toxin YdaT family protein -
NMK59_RS09385 (1976889) 1976889..1977344 - 456 WP_000273724.1 hypothetical protein -
NMK59_RS09390 (1977423) 1977423..1978538 + 1116 WP_001205820.1 hypothetical protein -
NMK59_RS09395 (1978545) 1978545..1979231 + 687 WP_000788749.1 ATP-binding protein -
NMK59_RS09400 (1979313) 1979313..1980083 + 771 WP_000450992.1 DUF1627 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T251831 WP_001303876.1 NZ_CP101302:c1975272-1974985 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT251831 WP_000536233.1 NZ_CP101302:c1975463-1975272 [Escherichia coli]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References