Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 1974985..1975463 | Replicon | chromosome |
| Accession | NZ_CP101302 | ||
| Organism | Escherichia coli strain 2000-3039 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | A0A891SFN9 |
| Locus tag | NMK59_RS09360 | Protein ID | WP_001303876.1 |
| Coordinates | 1974985..1975272 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | Q8XD67 |
| Locus tag | NMK59_RS09365 | Protein ID | WP_000536233.1 |
| Coordinates | 1975272..1975463 (-) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK59_RS09330 (1970135) | 1970135..1972606 | - | 2472 | WP_000034468.1 | exonuclease | - |
| NMK59_RS09335 (1972700) | 1972700..1972891 | - | 192 | WP_001098307.1 | DUF1482 family protein | - |
| NMK59_RS09340 (1972888) | 1972888..1973076 | - | 189 | WP_000413705.1 | cell division inhibition protein DicB | - |
| NMK59_RS09345 (1973650) | 1973650..1973835 | + | 186 | WP_001133046.1 | hypothetical protein | - |
| NMK59_RS09350 (1974022) | 1974022..1974411 | - | 390 | WP_000394511.1 | hypothetical protein | - |
| NMK59_RS09355 (1974553) | 1974553..1974708 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
| NMK59_RS09360 (1974985) | 1974985..1975272 | - | 288 | WP_001303876.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMK59_RS09365 (1975272) | 1975272..1975463 | - | 192 | WP_000536233.1 | hypothetical protein | Antitoxin |
| NMK59_RS09370 (1975491) | 1975491..1975892 | - | 402 | WP_000986592.1 | helix-turn-helix domain-containing protein | - |
| NMK59_RS09375 (1976001) | 1976001..1976273 | + | 273 | WP_000887453.1 | YdaS family helix-turn-helix protein | - |
| NMK59_RS09380 (1976257) | 1976257..1976682 | + | 426 | WP_000693855.1 | toxin YdaT family protein | - |
| NMK59_RS09385 (1976889) | 1976889..1977344 | - | 456 | WP_000273724.1 | hypothetical protein | - |
| NMK59_RS09390 (1977423) | 1977423..1978538 | + | 1116 | WP_001205820.1 | hypothetical protein | - |
| NMK59_RS09395 (1978545) | 1978545..1979231 | + | 687 | WP_000788749.1 | ATP-binding protein | - |
| NMK59_RS09400 (1979313) | 1979313..1980083 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10978.84 Da Isoelectric Point: 10.1360
>T251831 WP_001303876.1 NZ_CP101302:c1975272-1974985 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|