Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1347200..1347818 | Replicon | chromosome |
Accession | NZ_CP101302 | ||
Organism | Escherichia coli strain 2000-3039 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NMK59_RS06345 | Protein ID | WP_001291435.1 |
Coordinates | 1347200..1347418 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NMK59_RS06350 | Protein ID | WP_000344800.1 |
Coordinates | 1347444..1347818 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK59_RS06310 (1342489) | 1342489..1343061 | + | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
NMK59_RS06315 (1343092) | 1343092..1343403 | - | 312 | WP_000409911.1 | MGMT family protein | - |
NMK59_RS06325 (1343782) | 1343782..1344135 | + | 354 | WP_000878141.1 | DUF1428 family protein | - |
NMK59_RS06330 (1344177) | 1344177..1345727 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NMK59_RS06335 (1345891) | 1345891..1346361 | - | 471 | WP_000136192.1 | YlaC family protein | - |
NMK59_RS06340 (1346477) | 1346477..1347028 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NMK59_RS06345 (1347200) | 1347200..1347418 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NMK59_RS06350 (1347444) | 1347444..1347818 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NMK59_RS06355 (1348364) | 1348364..1351513 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NMK59_RS06360 (1351536) | 1351536..1352729 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T251830 WP_001291435.1 NZ_CP101302:c1347418-1347200 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT251830 WP_000344800.1 NZ_CP101302:c1347818-1347444 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |