Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1312902..1313739 | Replicon | chromosome |
Accession | NZ_CP101302 | ||
Organism | Escherichia coli strain 2000-3039 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A0F5GET7 |
Locus tag | NMK59_RS06175 | Protein ID | WP_000227783.1 |
Coordinates | 1312902..1313444 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NMK59_RS06180 | Protein ID | WP_001297137.1 |
Coordinates | 1313428..1313739 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK59_RS06155 (1308441) | 1308441..1309352 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
NMK59_RS06160 (1309520) | 1309520..1310011 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NMK59_RS06165 (1310139) | 1310139..1311503 | - | 1365 | WP_001000978.1 | MFS transporter | - |
NMK59_RS06170 (1311911) | 1311911..1312846 | + | 936 | WP_001434881.1 | tetratricopeptide repeat protein | - |
NMK59_RS06175 (1312902) | 1312902..1313444 | - | 543 | WP_000227783.1 | GNAT family N-acetyltransferase | Toxin |
NMK59_RS06180 (1313428) | 1313428..1313739 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NMK59_RS06185 (1313924) | 1313924..1314814 | - | 891 | WP_000971336.1 | heme o synthase | - |
NMK59_RS06190 (1314826) | 1314826..1315155 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NMK59_RS06195 (1315155) | 1315155..1315769 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NMK59_RS06200 (1315759) | 1315759..1317750 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NMK59_RS06205 (1317772) | 1317772..1318719 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19776.96 Da Isoelectric Point: 8.0330
>T251829 WP_000227783.1 NZ_CP101302:c1313444-1312902 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKQGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKQGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F5GET7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y6B3 |