Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 699762..700537 Replicon chromosome
Accession NZ_CP101302
Organism Escherichia coli strain 2000-3039

Toxin (Protein)


Gene name ypjF Uniprot ID -
Locus tag NMK59_RS03245 Protein ID WP_001193489.1
Coordinates 700166..700537 (+) Length 124 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7V7JFU6
Locus tag NMK59_RS03240 Protein ID WP_001059301.1
Coordinates 699762..700127 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK59_RS03205 (695799) 695799..696515 + 717 WP_000174910.1 WYL domain-containing protein -
NMK59_RS03210 (696551) 696551..697003 + 453 WP_000734322.1 hypothetical protein -
NMK59_RS03215 (697075) 697075..697548 + 474 WP_001298943.1 hypothetical protein -
NMK59_RS03220 (697668) 697668..698489 + 822 WP_001234408.1 DUF932 domain-containing protein -
NMK59_RS03225 (698520) 698520..698963 + 444 WP_001096016.1 antirestriction protein -
NMK59_RS03230 (698976) 698976..699518 + 543 WP_015740440.1 DNA repair protein RadC -
NMK59_RS03235 (699515) 699515..699736 + 222 WP_000691983.1 DUF987 domain-containing protein -
NMK59_RS03240 (699762) 699762..700127 + 366 WP_001059301.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NMK59_RS03245 (700166) 700166..700537 + 372 WP_001193489.1 TA system toxin CbtA family protein Toxin
NMK59_RS03250 (701337) 701337..701480 - 144 Protein_629 HNH endonuclease -
NMK59_RS03255 (701580) 701580..701684 + 105 Protein_630 HNH endonuclease -
NMK59_RS03260 (701692) 701692..702672 - 981 WP_000991444.1 sialate O-acetylesterase -
NMK59_RS03265 (702737) 702737..703843 - 1107 WP_001298927.1 N-acetylneuraminate epimerase -
NMK59_RS03270 (703863) 703863..704579 - 717 WP_001295734.1 N-acetylneuraminic acid outer membrane channel NanC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB / fimE / fimA / fimI / fimC 693711..710106 16395


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 124 a.a.        Molecular weight: 13875.97 Da        Isoelectric Point: 7.6717

>T251827 WP_001193489.1 NZ_CP101302:700166-700537 [Escherichia coli]
MQTISSHPTRATQPCLSPVEIWQRLLTCLLSQHYGLTLNDTPFSNETTILEHIDAGVSLCDAVNFLVEKYERVRIDCNDC
SVMEKSPFITSIDILRARKASGLMKRNSHKTVTRVTAGRLQEL

Download         Length: 372 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13388.25 Da        Isoelectric Point: 5.9530

>AT251827 WP_001059301.1 NZ_CP101302:699762-700127 [Escherichia coli]
MNNHSESGTKPENPACQQWGLKCAITPCFGARLVQEGNRLHFLSDRAGFSGAFAVDVAMRLDQAFPLMMKQLELMLTSGE
LNPRHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7V7JFU6

References