Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 28549..29192 Replicon plasmid pO26-1
Accession NZ_CP101295
Organism Escherichia coli strain 2003-3014

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag NMK58_RS30115 Protein ID WP_024017568.1
Coordinates 28549..28965 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag NMK58_RS30120 Protein ID WP_001261287.1
Coordinates 28962..29192 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK58_RS30085 (NMK58_30085) 23711..24385 - 675 WP_001341423.1 IS66-like element accessory protein TnpA -
NMK58_RS30090 (NMK58_30090) 24469..24825 - 357 Protein_17 tyrosine-type recombinase/integrase -
NMK58_RS30095 (NMK58_30095) 24953..25813 + 861 WP_000704534.1 alpha/beta hydrolase -
NMK58_RS30100 (NMK58_30100) 26428..26577 + 150 WP_000955366.1 hypothetical protein -
NMK58_RS30110 (NMK58_30110) 27842..28387 + 546 WP_001165114.1 hypothetical protein -
NMK58_RS30115 (NMK58_30115) 28549..28965 - 417 WP_024017568.1 type II toxin-antitoxin system VapC family toxin Toxin
NMK58_RS30120 (NMK58_30120) 28962..29192 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NMK58_RS30125 (NMK58_30125) 29752..30165 + 414 WP_000465041.1 hypothetical protein -
NMK58_RS30130 (NMK58_30130) 30167..30949 + 783 WP_001164205.1 site-specific integrase -
NMK58_RS30135 (NMK58_30135) 31122..31475 + 354 WP_000864810.1 colicin M immunity protein -
NMK58_RS30140 (NMK58_30140) 31483..31674 - 192 Protein_27 lipid II-degrading bacteriocin -
NMK58_RS30145 (NMK58_30145) 31678..31821 - 144 Protein_28 transcriptional regulator -
NMK58_RS30150 (NMK58_30150) 31888..33327 - 1440 WP_001213545.1 enterohemolysin T1SS ABC transporter subunit EhxD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - toxB / hlyD / hlyB / hlyA / hlyC / espP 1..90123 90123


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15196.72 Da        Isoelectric Point: 8.7503

>T251823 WP_024017568.1 NZ_CP101295:c28965-28549 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDKFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT251823 WP_001261287.1 NZ_CP101295:c29192-28962 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References