Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4880035..4880689 | Replicon | chromosome |
Accession | NZ_CP101292 | ||
Organism | Escherichia coli strain 2003-3014 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | NMK58_RS25260 | Protein ID | WP_000244777.1 |
Coordinates | 4880035..4880442 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | NMK58_RS25265 | Protein ID | WP_000354043.1 |
Coordinates | 4880423..4880689 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK58_RS25240 (4875992) | 4875992..4877725 | - | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NMK58_RS25245 (4877731) | 4877731..4878441 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NMK58_RS25250 (4878466) | 4878466..4879362 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NMK58_RS25255 (4879474) | 4879474..4879995 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NMK58_RS25260 (4880035) | 4880035..4880442 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
NMK58_RS25265 (4880423) | 4880423..4880689 | - | 267 | WP_000354043.1 | FAD assembly factor SdhE | Antitoxin |
NMK58_RS25270 (4880932) | 4880932..4881912 | + | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
NMK58_RS25275 (4882108) | 4882108..4882767 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
NMK58_RS25280 (4882931) | 4882931..4883242 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
NMK58_RS25285 (4883287) | 4883287..4884720 | + | 1434 | WP_001341859.1 | 6-phospho-beta-glucosidase BglA | - |
NMK58_RS25290 (4884777) | 4884777..4885520 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T251820 WP_000244777.1 NZ_CP101292:c4880442-4880035 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|